Proteintech, 27571-1-AP, GLUT5 Polyclonal antibody

Size: 20ul / 150ul The GLUT5 (27571-1-AP) by Proteintech is a Polyclonal antibody targeting GLUT5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27571-1-AP targets GLUT5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Caco-2 cells, A549 cells, mouse kidney tissue, rat testis tissue Positive IHC detected in: human breast cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GLUT5, also known as SLC2A5, is a fructose transporter expressed on the apical border of enterocytes in the small intestine. GLUT5 allows for fructose to be transported from the intestinal lumen into the enterocyte by facilitated diffusion due to fructose's high concentration in the intestinal lumen (PMID: 12750891). GLUT5 is also expressed in skeletal muscle, testis, kidney, fat tissue (adipocytes), and brain (PMID: 9781312, 18398011). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25682 Product name: Recombinant human SLC2A5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 357-399 aa of BC001820 Sequence: CVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLI Predict reactive species Full Name: solute carrier family 2 (facilitated glucose/fructose transporter), member 5 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 48-70 kDa GenBank Accession Number: BC001820 Gene Symbol: GLUT5 Gene ID (NCBI): 6518 RRID: AB_2880913 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22732 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.