Proteintech, 27573-1-AP, MAP7D3 Polyclonal antibody

Size: 20ul / 150ul The MAP7D3 (27573-1-AP) by Proteintech is a Polyclonal antibody targeting MAP7D3 in WB, ELISA applications with reactivity to human samples 27573-1-AP targets MAP7D3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, HeLa cells, MDA-MB-468 cells, SH-SY5Y cells, SK-N-SH cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information MAP7D3, also known as MDP3, features two coiled-coil regions near its N terminus, followed by a linker region, a MAP7-like domain, and a C-terminal domain. MAP7D3 is a microtubule-binding protein that regulates microtubule assembly and stability. MAP7D3 expression is cell cycle dependent, with lower expression in the G2 phase compared to its expression in the other phases of the cell cycle(PMID: 22142902). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26082 Product name: Recombinant human MAP7D3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 301-400 aa of NM_001173516 Sequence: ASVDAPPQVNVEVFCNTSMEASPKAGVGMAPEVSTDSFPVVSVDVSPVVSTYDSEMSMDASPELSIEALPKVDLETVPKVSIVASPEASLEAPPEVSLEA Predict reactive species Full Name: MAP7 domain containing 3 Calculated Molecular Weight: 98 kDa Observed Molecular Weight: 125-130 kDa GenBank Accession Number: NM_001173516 Gene Symbol: MAP7D3 Gene ID (NCBI): 79649 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWC1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.