Iright
BRAND / VENDOR: Proteintech

Proteintech, 27598-1-AP, ORMDL3 Polyclonal antibody

CATALOG NUMBER: 27598-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ORMDL3 (27598-1-AP) by Proteintech is a Polyclonal antibody targeting ORMDL3 in WB, ELISA applications with reactivity to human, mouse, rat samples 27598-1-AP targets ORMDL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information ORMDL3 (ORM1-like 3) is an endoplasmic-reticulum (ER)-resident transmembrane protein that negatively regulates serine palmitoyl-transferase (SPT), the first and rate-limiting enzyme of de-novo sphingolipid biosynthesis, thereby controlling cellular ceramide levels. (PMID: 31376405) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26253 Product name: Recombinant human ORMDL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC071833 Sequence: MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRK Predict reactive species Full Name: ORM1-like 3 (S. cerevisiae) Calculated Molecular Weight: 153 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC071833 Gene Symbol: ORMDL3 Gene ID (NCBI): 94103 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N138 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924