Product Description
Size: 20ul / 150ul
The ORMDL3 (27598-1-AP) by Proteintech is a Polyclonal antibody targeting ORMDL3 in WB, ELISA applications with reactivity to human, mouse, rat samples
27598-1-AP targets ORMDL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HepG2 cells, L02 cells, mouse testis tissue, rat testis tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Background Information
ORMDL3 (ORM1-like 3) is an endoplasmic-reticulum (ER)-resident transmembrane protein that negatively regulates serine palmitoyl-transferase (SPT), the first and rate-limiting enzyme of de-novo sphingolipid biosynthesis, thereby controlling cellular ceramide levels. (PMID: 31376405)
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26253 Product name: Recombinant human ORMDL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC071833 Sequence: MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRK Predict reactive species
Full Name: ORM1-like 3 (S. cerevisiae)
Calculated Molecular Weight: 153 aa, 17 kDa
Observed Molecular Weight: 17 kDa
GenBank Accession Number: BC071833
Gene Symbol: ORMDL3
Gene ID (NCBI): 94103
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8N138
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924