Proteintech, 27602-1-AP, ASPN Polyclonal antibody

Size: 20ul / 150ul The ASPN (27602-1-AP) by Proteintech is a Polyclonal antibody targeting ASPN in WB, IHC, ELISA applications with reactivity to human samples 27602-1-AP targets ASPN in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, SW480 cells, HeLa cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ASPN, also known as periodontal ligament-associated protein1 (PLAP1), is an extracellular matrix (ECM) protein. The calculated molecular weight of ASPN is 43 kDa. It belongs to the small leucine-rich proteoglycans (SLRPs) family and contains a unique aspartate-rich N terminus that distinguishes it from other SLRPs family members. It was firstly identified in human cartilage and it was associated with the pathogenesis of bone and joint diseases, including osteoarthritis, intervertebral disc degeneration and periodontal ligament mineralization (PMID:11152692; 26089687). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26380 Product name: Recombinant human ASPN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 53-330 aa of BC063114 Sequence: DDEEDNSLFPTREPRSHFFPFDLFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKENDFKGLTSLYGLILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGLPPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNKLKKIPSGLPELKYLQIIFLHSNSIAR Predict reactive species Full Name: asporin Calculated Molecular Weight: 384 aa, 44 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC063114 Gene Symbol: ASPN Gene ID (NCBI): 54829 RRID: AB_3085974 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXN1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.