Proteintech, 27603-1-AP, C17orf57 Polyclonal antibody

Size: 20ul / 150ul The C17orf57 (27603-1-AP) by Proteintech is a Polyclonal antibody targeting C17orf57 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 27603-1-AP targets C17orf57 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24015 Product name: Recombinant human C17orf57 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-162 aa of BC036407 Sequence: METKVHLFCQAEENIDLLDDGSNSFATDLSSGTINHKKYIKFSKTIEKEISPEIRSLSPEYKKIFETSIIFCGEEKSSDFSGEKKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSLCKLPNQYSVHKTSSPLCTSSAITREKEMLSNLYMTLYDEVT Predict reactive species Full Name: chromosome 17 open reading frame 57 Observed Molecular Weight: 110 kDa GenBank Accession Number: BC036407 Gene Symbol: C17orf57 Gene ID (NCBI): 124989 RRID: AB_3085975 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IY85 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.