Proteintech, 27610-1-AP, FBXO11 Polyclonal antibody

Size: 20ul / 150ul The FBXO11 (27610-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO11 in WB, IP, ELISA applications with reactivity to Human samples 27610-1-AP targets FBXO11 in WB, IP, CoIP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, U2OS cells Positive IP detected in: LNCaP cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24401 Product name: Recombinant human FBXO11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 858-927 aa of BC012728 Sequence: TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN Predict reactive species Full Name: F-box protein 11 Calculated Molecular Weight: 927 aa, 104 kDa Observed Molecular Weight: 94-104 kDa GenBank Accession Number: BC012728 Gene Symbol: FBXO11 Gene ID (NCBI): 80204 RRID: AB_2880925 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86XK2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.