Proteintech, 27612-1-AP, FAM53C Polyclonal antibody

Size: 20ul / 150ul The FAM53C (27612-1-AP) by Proteintech is a Polyclonal antibody targeting FAM53C in WB, ELISA applications with reactivity to Human samples 27612-1-AP targets FAM53C in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14219 Product name: Recombinant human FAM53C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-392 aa of BC000259 Sequence: MITLITEQLQKQTLDELKCTRFSISLPLPDHADISNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRGNSPKEQPFSQVLRPEPPDPEKLPVPPAPPSKRHCRSLSVPVDLSRWQPVWRPAPSKLWTPIKHRGSGGGGGPQVPHQSPPKRVSSLRFLQAPSASSQCAPAHRPYSPPFFSLALAQDSSRPCAASPQSGSWESDAESLSPCPPQRRFSLSPSLGPQASRFLPSARSSPASSPELPWRPRGLRNLPRSRSQPCDLDARKTGVKRRHEEDPRRLRPSLDFDKMNQKPYSGGLCLQETAREGSSISPPWFMACSPPPLSASCSPTGGSSQVLSESEEEEEGAVRWGRQALSKRTLCQRDFGDLDLNLIEEN Predict reactive species Full Name: family with sequence similarity 53, member C Calculated Molecular Weight: 392 aa, 43 kDa Observed Molecular Weight: 43-55 kDa GenBank Accession Number: BC000259 Gene Symbol: FAM53C Gene ID (NCBI): 51307 RRID: AB_3085976 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYF3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.