Proteintech, 27636-1-AP, SLC38A6 Polyclonal antibody

Size: 20ul / 150ul The SLC38A6 (27636-1-AP) by Proteintech is a Polyclonal antibody targeting SLC38A6 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 27636-1-AP targets SLC38A6 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Background Information SLC38A6 is also known as SNAT6 and belongs to the amino acid/polyamine transporter 2 family. SLC38A6 is probably a sodium-dependent amino acid/proton antiporter or a neuronal transporter for glutamate. SLC38A6 has 2 isoforms with the molecular mass of 51 kDa and 58 kDa. The observed molecular weight of SLC38A6 is 43 kDa, which is consistent with the description in the literature of MW between 37 kDa and 50 kDa (PMID: 24752331). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24654 Product name: Recombinant human SLC38A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 142-250 aa of BC110378 Sequence: IIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA Predict reactive species Full Name: solute carrier family 38, member 6 Calculated Molecular Weight: 456 aa, 51 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC110378 Gene Symbol: SLC38A6 Gene ID (NCBI): 145389 RRID: AB_3085978 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.