Proteintech, 27642-1-AP, Neutrophil Elastase Polyclonal antibody

Size: 20ul / 150ul The Neutrophil Elastase (27642-1-AP) by Proteintech is a Polyclonal antibody targeting Neutrophil Elastase in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 27642-1-AP targets Neutrophil Elastase in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: THP-1 cells, U-937 cells Positive IHC detected in: human lymphoma tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ELA2(Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation(PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation)(PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration(PMID:9683424). The full length protein has a signal peptide,propeptide and three glycosylation sites. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26634 Product name: Recombinant human ELA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 206-267 aa of BC074816 Sequence: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH Predict reactive species Full Name: elastase 2, neutrophil Calculated Molecular Weight: 267 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC074816 Gene Symbol: ELA2 Gene ID (NCBI): 1991 RRID: AB_2918126 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08246 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.