Iright
BRAND / VENDOR: Proteintech

Proteintech, 27655-1-AP, ZFX Polyclonal antibody

CATALOG NUMBER: 27655-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZFX (27655-1-AP) by Proteintech is a Polyclonal antibody targeting ZFX in WB, ELISA applications with reactivity to Human, rat samples 27655-1-AP targets ZFX in WB, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, K-562 cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information ZFX (Zinc finger protein, X-linked), a key factor that controls the self-renewal of ESCs, belongs to the ZFY family whose members (ZFX, ZFY, ZFA) have similar molecular structures. Mammalian ZFX contains an acidic transcriptional activation domain, a nuclear localization signal (NLS) sequence, and a DNA binding domain consisting of 13 C2H2 zinc fingers. Knocking out ZFX has been shown to impair the self-renewal capacity of mouse ESC and tissue-specific adult stem cell such as hematopoietic stem cells (HSCs) without affecting their differentiation, and ZFX overexpression has been shown to promote ESC self-renewal by impeding differentiation. It's reported that t the 130 kDa band was N-glycosylated, and such a posttranslational modification (PTM) may control the nuclear import of ZFX, 91 kDa may be the non-N-glycosylated subtype which was lowly expressed. (PMID: 23322077, PMID:24228108) Specification Tested Reactivity: Human, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26576 Product name: Recombinant human ZFX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 711-805 aa of NM_001178084 Sequence: MSVHTKDLPFRCKRCRKGFRQQSELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKGFRRPSEKNQHIMRHHKEVGLP Predict reactive species Full Name: zinc finger protein, X-linked Calculated Molecular Weight: 91 kDa Observed Molecular Weight: ~130 kDa GenBank Accession Number: NM_001178084 Gene Symbol: ZFX Gene ID (NCBI): 7543 RRID: AB_3085980 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17010 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924