Iright
BRAND / VENDOR: Proteintech

Proteintech, 27667-1-AP, RSL1D1 Polyclonal antibody

CATALOG NUMBER: 27667-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RSL1D1 (27667-1-AP) by Proteintech is a Polyclonal antibody targeting RSL1D1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples 27667-1-AP targets RSL1D1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: U-251 cells, HCT 116 cells, HEK-293 cells, SW480 cells, K-562 cells, HepG2 cells, PC-3 cells Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information RL1D1, Ribosomal L1 domain-containing protein 1, also named CSIG, a member of the universal ribosomal protein uL1 family. RL1D1 regulates cellular senescence through inhibition of PTEN translation. It acts as a pro-apoptotic regulator in response to DNA damage (PMID: 18678645, PMID: 22419112). RSL1D1 promoted the progression of colorectal cancer through RAN-mediated autophagy suppression. RSL1D1 can be detected 70 kDa (PMID:35013134). Specification Tested Reactivity: Human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24923 Product name: Recombinant human RSL1D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 269-490 aa of BC112228 Sequence: SNWDEATKRSLLNKKKKEARRKRRERNFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQLVPIGKKTPANEKVEIQKHATGKKSPAKSPNPSTPRGKKRKALPASETPKAAESETPGKSPEKKPKIKEEAVKEKSPSLGKKDARQTPKKPEAKFFTTPSKSVRKASHTPKKWPKKPKVPQST Predict reactive species Full Name: ribosomal L1 domain containing 1 Calculated Molecular Weight: 490 aa, 55 kDa Observed Molecular Weight: 55-70 kDa GenBank Accession Number: BC112228 Gene Symbol: RSL1D1 Gene ID (NCBI): 26156 RRID: AB_3085982 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O76021 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924