Iright
BRAND / VENDOR: Proteintech

Proteintech, 27679-1-AP, SAP30 Polyclonal antibody

CATALOG NUMBER: 27679-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SAP30 (27679-1-AP) by Proteintech is a Polyclonal antibody targeting SAP30 in WB, ELISA applications with reactivity to Human samples 27679-1-AP targets SAP30 in WB, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HL-60 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SAP30, also named as Sin3 corepressor complex subunit SAP30, is a 220 amino acid protein, which is expressed in all tissues tested with highest levels in pancreas, ovary, PBL, spleen and thymus. SAP30 is involved in the functional recruitment of the Sin3-histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26516 Product name: Recombinant human SAP30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-197 aa of BC016757 Sequence: CLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTL Predict reactive species Full Name: Sin3A-associated protein, 30kDa Calculated Molecular Weight: 220 aa, 23 kDa Observed Molecular Weight: 23-28 kDa GenBank Accession Number: BC016757 Gene Symbol: SAP30 Gene ID (NCBI): 8819 RRID: AB_2880945 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75446 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924