Iright
BRAND / VENDOR: Proteintech

Proteintech, 27691-1-AP, AVPR2 Polyclonal antibody

CATALOG NUMBER: 27691-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AVPR2 (27691-1-AP) by Proteintech is a Polyclonal antibody targeting AVPR2 in WB, ELISA applications with reactivity to human samples 27691-1-AP targets AVPR2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: 769-P cells, 786-O cells, Caki-1 cells, Caki-2 cells, OS-RC-2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information AVPR2 is a Gs-coupled vasopressin receptor essential for renal water reabsorption, acting through cAMP-PKA-dependent trafficking of aquaporin-2. Localized to principal cells of the collecting duct, AVPR2 integrates hormonal cues to maintain osmotic and fluid homeostasis. Mutations lead to X-linked nephrogenic diabetes insipidus, while rare activating variants cause SIADH. Because of its central role in renal physiology and clear clinical associations, AVPR2 is a key target in water-balance disorders and pharmacologic modulation of diuresis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24835 Product name: Recombinant human AVPR2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-83 aa of BC112181 Sequence: MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCL Predict reactive species Full Name: arginine vasopressin receptor 2 Calculated Molecular Weight: 371 aa, 40 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC112181 Gene Symbol: AVPR2 Gene ID (NCBI): 554 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30518 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924