Iright
BRAND / VENDOR: Proteintech

Proteintech, 27693-1-AP, REL Polyclonal antibody

CATALOG NUMBER: 27693-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The REL (27693-1-AP) by Proteintech is a Polyclonal antibody targeting REL in WB, ELISA applications with reactivity to Human samples 27693-1-AP targets REL in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Daudi cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information REL, also known as, Proto-oncogene c-Rel, is a 619 amino acid protein, which may play a role in differentiation and lymphopoiesis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator. Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26776 Product name: Recombinant human REL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 279-471 aa of NM_001291746 Sequence: MYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVG Predict reactive species Full Name: v-rel reticuloendotheliosis viral oncogene homolog (avian) Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 68-78 kDa GenBank Accession Number: NM_001291746 Gene Symbol: REL Gene ID (NCBI): 5966 RRID: AB_3669617 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q04864 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924