Proteintech, 27701-1-AP, ANKRD17 Polyclonal antibody

Size: 20ul / 150ul The ANKRD17 (27701-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD17 in WB, IHC, ELISA applications with reactivity to human samples 27701-1-AP targets ANKRD17 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ANKRD17 belongs to the family of ankyrin repeat-containing proteins, and contains two distinct arrays of ankyrin repeats in its amino-terminal region. It also contains a nuclear export signal, nuclear localization signal, and a cyclin-binding RXL motif. Localization of this protein to the nucleus has been shown experimentally, and interactions between this protein and cyclin-dependent kinase 2 have been observed. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26767 Product name: Recombinant human ANKRD17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1553-1684 aa of NM_001286771 Sequence: MGSHGKRNNTITTTSSKRKNRKNKITPENVQIIFDDPLPISYSQPEKVNGESKSSSTSESGDSDNMRISSCSDESSNSNSSRKSDNHSPAVVTTTVSSKKQPSVLVTFPKEERKSVSGKASIKLSETISEGTS Predict reactive species Full Name: ankyrin repeat domain 17 Calculated Molecular Weight: 274 kDa Observed Molecular Weight: 270-300 kDa GenBank Accession Number: NM_001286771 Gene Symbol: ANKRD17 Gene ID (NCBI): 26057 RRID: AB_3085987 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75179 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.