Proteintech, 27703-1-AP, Cadherin-6 Polyclonal antibody

Size: 20ul / 150ul The Cadherin-6 (27703-1-AP) by Proteintech is a Polyclonal antibody targeting Cadherin-6 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 27703-1-AP targets Cadherin-6 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: rat kidney tissue, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Cadherin-6 (CDH6), also known as K-cadherin, is a class II cadherin involved in the morphogenesis of the central nervous system and kidney (PMID: 27375021). Expression of cadherin-6 has also been described in some cancers, including renal cancer, ovarian cancer, gastric cancer, and thyroid cancer (PMID: 14665853; 28526733; 34530820). Cadherin-6 is involved in epithelial-mesenchymal transition (EMT) and cancer metastasis (PMID: 27375021). Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26756 Product name: Recombinant human CDH6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 619-663 aa of BC000019 Sequence: ILLCIVILLGKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI Predict reactive species Full Name: cadherin 6, type 2, K-cadherin (fetal kidney) Calculated Molecular Weight: 790 aa, 88 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC000019 Gene Symbol: Cadherin-6 Gene ID (NCBI): 1004 RRID: AB_3085988 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55285 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.