Iright
BRAND / VENDOR: Proteintech

Proteintech, 27712-1-AP, COX14 Polyclonal antibody

CATALOG NUMBER: 27712-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COX14 (27712-1-AP) by Proteintech is a Polyclonal antibody targeting COX14 in WB, IF/ICC, ELISA applications with reactivity to human samples 27712-1-AP targets COX14 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24036 Product name: Recombinant human C12orf62 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC007849 Sequence: MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEEQKTSGIM Predict reactive species Full Name: Cytochrome c oxidase assembly protein COX14 Observed Molecular Weight: 7-12 kDa GenBank Accession Number: BC007849 Gene Symbol: C12orf62 Gene ID (NCBI): 84987 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96I36 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924