Product Description
Size: 20ul / 150ul
The COX14 (27712-1-AP) by Proteintech is a Polyclonal antibody targeting COX14 in WB, IF/ICC, ELISA applications with reactivity to human samples
27712-1-AP targets COX14 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293 cells, HepG2 cells
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24036 Product name: Recombinant human C12orf62 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC007849 Sequence: MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEEQKTSGIM Predict reactive species
Full Name: Cytochrome c oxidase assembly protein COX14
Observed Molecular Weight: 7-12 kDa
GenBank Accession Number: BC007849
Gene Symbol: C12orf62
Gene ID (NCBI): 84987
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96I36
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924