Proteintech, 27717-1-AP, FAR2 Polyclonal antibody

Size: 20ul / 150ul The FAR2 (27717-1-AP) by Proteintech is a Polyclonal antibody targeting FAR2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27717-1-AP targets FAR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Neuro-2a cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human colon cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information Fatty acyl-CoA reductase 2 (FAR2), also known as MLSTD1, belongs to the fatty acyl-CoA reductase family. FAR2 catalyzes the reduction of saturated but not unsaturated C16 or C18 fatty acyl-CoA to fatty alcohols (PMID: 24009241). FAR2 may play a role in the production of ether lipids/plasmalogens and wax monoesters which synthesis requires fatty alcohols as substrates. FAR2 has 2 isoforms with the molecular mass of 49 kDa and 59 kDa (Refer to Uniprot). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26819 Product name: Recombinant human FAR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-104 aa of BC022267 Sequence: LQQRVFQILDSKLFEKVKEVCPNVHEKIRAIYADLNQNDFAISKEDMQELLSC Predict reactive species Full Name: fatty acyl CoA reductase 2 Calculated Molecular Weight: 515 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC022267 Gene Symbol: FAR2 Gene ID (NCBI): 55711 RRID: AB_3669618 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96K12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.