Iright
BRAND / VENDOR: Proteintech

Proteintech, 27727-1-AP, ABI3BP Polyclonal antibody

CATALOG NUMBER: 27727-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ABI3BP (27727-1-AP) by Proteintech is a Polyclonal antibody targeting ABI3BP in WB, ELISA applications with reactivity to Human, Mouse samples 27727-1-AP targets ABI3BP in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: C2C12 cell, mouse thymus tissue, C2C12 cells, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26841 Product name: Recombinant human ABI3BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-419 aa of BC030221 Sequence: GSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILVHLIIPGLNETTVKLPASLMFEISDALKTQLAKNETLALPAESKTPEVEKISARPTTVTPETVPRSTKPTTSSALDVSETTLASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISDSYTATSDRILDSIP Predict reactive species Full Name: ABI family, member 3 (NESH) binding protein Calculated Molecular Weight: 119 kDa Observed Molecular Weight: 54 kDa, 72 kDa GenBank Accession Number: BC030221 Gene Symbol: ABI3BP Gene ID (NCBI): 25890 RRID: AB_2880955 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z7G0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924