Product Description
Size: 20ul / 150ul
The SLC26A2 (27759-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples
27759-1-AP targets SLC26A2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse colon tissue, rat colon tissue
Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells
Positive FC (Intra) detected in: U2OS cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:2000-1:8000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, canine
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26521 Product name: Recombinant human SLC26A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC059390 Sequence: MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGDV Predict reactive species
Full Name: solute carrier family 26 (sulfate transporter), member 2
Calculated Molecular Weight: 82 kDa
Observed Molecular Weight: 68 kDa
GenBank Accession Number: BC059390
Gene Symbol: SLC26A2
Gene ID (NCBI): 1836
RRID: AB_2880963
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P50443
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924