Iright
BRAND / VENDOR: Proteintech

Proteintech, 27792-1-AP, Oncostatin M Polyclonal antibody

CATALOG NUMBER: 27792-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Oncostatin M (27792-1-AP) by Proteintech is a Polyclonal antibody targeting Oncostatin M in WB, IHC, ELISA applications with reactivity to human, rat samples 27792-1-AP targets Oncostatin M in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, Jurkat cells, rat testis tissue Positive IHC detected in: human colon cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Oncostatin M (OSM) is a multifunctional cytokine that belongs to the interleukin-6 (IL-6) family. It is primarily secreted by activated T lymphocytes and macrophages as a 28 kDa glycoprotein. OSM shares properties with all members of this cytokine family, but is most closely related in structure and function to leukemia inhibitory factor (LIF). OSM acts on a variety of cells and is involved in regulating gene activation, cell growth, and inflammatory processes. It is a potent inducer of anti-proteases, has anti-inflammatory properties, acts as an immune modifier, and promotes the deposition of extracellular matrix proteins . In the context of respiratory diseases, OSM may play a significant role in normal wound healing, as well as in remodeling and pathological fibrosis. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27093 Product name: Recombinant human OSM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-221 aa of BC011589 Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR Predict reactive species Full Name: oncostatin M Calculated Molecular Weight: 252 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC011589 Gene Symbol: OSM Gene ID (NCBI): 5008 RRID: AB_2880974 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13725 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924