Product Description
Size: 20ul / 150ul
The SPG7 (27801-1-AP) by Proteintech is a Polyclonal antibody targeting SPG7 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples
27801-1-AP targets SPG7 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, LNCaP cells
Positive IP detected in: HeLa cells
Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
SPG7 encodes a nuclear-encoded mitochondrial metalloprotease protein that is a member of the AAA protein family. Two transcript variants encoding distinct isoforms have been identified. The molecular weight of SPG7 is about 88-100 kDa (precursor),80 kDa (intermediate) and 70 kDa (mature)(PMID: 24767997), while the molecular weight of isoform 2 is about 54 kDa.
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26265 Product name: Recombinant human SPG7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-45 aa of BC007692 Sequence: VATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVY Predict reactive species
Full Name: spastic paraplegia 7 (pure and complicated autosomal recessive)
Calculated Molecular Weight: 88 kDa
Observed Molecular Weight: 54 kDa, 70 kDa, 80kDa
GenBank Accession Number: BC007692
Gene Symbol: SPG7
Gene ID (NCBI): 6687
RRID: AB_2918133
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UQ90
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924