Proteintech, 27816-1-AP, CD151 Polyclonal antibody

Size: 20ul / 150ul The CD151 (27816-1-AP) by Proteintech is a Polyclonal antibody targeting CD151 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27816-1-AP targets CD151 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: unboiled A431 cells, mouse heart tissue, unboiled A549 cells, rat heart tissue Positive IHC detected in: human ovary tumor tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CD151 (also known as TSPAN24) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are involved in the regulation of cell development, activation, growth and motility. CD151 is broadly expressed by a variety of cell types. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. CD151 enhances cell motility, invasion and metastasis of cancer cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25968 Product name: Recombinant human CD151 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-221 aa of BC001374 Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR Predict reactive species Full Name: CD151 molecule (Raph blood group) Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC001374 Gene Symbol: CD151 Gene ID (NCBI): 977 RRID: AB_2923579 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48509 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.