Proteintech, 27828-1-AP, SIGIRR Polyclonal antibody

Size: 20ul / 150ul The SIGIRR (27828-1-AP) by Proteintech is a Polyclonal antibody targeting SIGIRR in WB, IHC, ELISA applications with reactivity to human, mouse samples 27828-1-AP targets SIGIRR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SIGIRR (also known as TIR8) is a member of the toll-like receptor (TLR)/interleukin 1 receptor (IL-1R) superfamily, with a single immunoglobulin extracellular domain and a TIR (Toll/IL-1R) intracellular domain. SIGIRR functions as a negative regulator for IL-1 and LPS signaling, through its interaction with the TLR4 and IL-1R complex. SIGIRR is an important modulator of intestinal epithelial homeostasis and a key regulator of mucosal immunity, maintaining microbial tolerance of the intestinal epithelial layer (PMID: 17398123). The molecular weight of the glycosylated SIGIRR was found to be in the range 50-80 kDa (PMID: 10346978; 17495864). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25850 Product name: Recombinant human SIGIRR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC025953 Sequence: MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH Predict reactive species Full Name: single immunoglobulin and toll-interleukin 1 receptor (TIR) domain Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC025953 Gene Symbol: SIGIRR Gene ID (NCBI): 59307 RRID: AB_2880984 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6IA17 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.