Iright
BRAND / VENDOR: Proteintech

Proteintech, 27830-1-AP, HSD17B1 Polyclonal antibody

CATALOG NUMBER: 27830-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSD17B1 (27830-1-AP) by Proteintech is a Polyclonal antibody targeting HSD17B1 in WB, IHC, ELISA applications with reactivity to Human samples 27830-1-AP targets HSD17B1 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27213 Product name: Recombinant human HSD17B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 191-328 aa of BC104752 Sequence: TAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRSAVGDPELGDPPAAPQ Predict reactive species Full Name: hydroxysteroid (17-beta) dehydrogenase 1 Calculated Molecular Weight: 328 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC104752 Gene Symbol: HSD17B1 Gene ID (NCBI): 3292 RRID: AB_2880985 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14061 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924