Iright
BRAND / VENDOR: Proteintech

Proteintech, 27835-1-AP, RASA2/3 Polyclonal antibody

CATALOG NUMBER: 27835-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RASA2/3 (27835-1-AP) by Proteintech is a Polyclonal antibody targeting RASA2/3 in WB, ELISA applications with reactivity to Human, mouse samples 27835-1-AP targets RASA2/3 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: 3T3-L1 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Rasa3 is a GTPase activating protein of the GAP1 family which targets R-Ras and Rap1. While R-Ras has been extensively studied due to its involvement in cancer, Rap1 has recently attracted a lot of attention due to its central role in development and morphogenesis of higher organisms, especially in the cardiovasculature. This antibody can react with RASA2 and RASA3. Specification Tested Reactivity: Human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27152 Product name: Recombinant human RASA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 563-834 aa of BC038456 Sequence: SSGRRDPKSVEQPIVLKEGFMIKRAQGRKRFGMKNFKKRWFRLTNHEFTYHKSKGDQPLYSIPIENILAVEKLEEESFKMKNMFQVIQPERALYIQANNCVEAKDWIDILTKVSQCNQKRLTVYHPSAYLSGHWLCCRAPSDSAPGCSPCTGGLPANIQLDIDGDRETERIYSLFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQEHPIGDKSFQNYIRQQSETSTHSI Predict reactive species Full Name: RAS p21 protein activator 3 Calculated Molecular Weight: 834 aa, 96 kDa Observed Molecular Weight: 96 kDa GenBank Accession Number: BC038456 Gene Symbol: RASA3 Gene ID (NCBI): 22821 RRID: AB_2880988 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14644 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924