Proteintech, 27836-1-AP, SEMA3A Polyclonal antibody

Size: 20ul / 150ul The SEMA3A (27836-1-AP) by Proteintech is a Polyclonal antibody targeting SEMA3A in WB, IF/ICC, ELISA applications with reactivity to Human samples 27836-1-AP targets SEMA3A in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: PC-12 cells, SH-SY5Y cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SEMA3A (Semaphorin 3A), a class-3 semaphorin signaling protein, is involved in cell signaling with PlexinA1 and Neuropilin-1 (NRP1) receptors and it is responsible for recruiting dendritic cells into lymphatics. It's widely expressed in different tissues (PMID:10766232). SEMA3A has been shown to exert osteoprotective effects, characterized by increasing bone formation while inhibiting the activation of osteoclast precursor cells (PMID:36598593). However, SEMA3A also modulates the immune system. SEMA3A expression in a myocardial infarct area enhances macrophage polarization and inhibits monocyte migration into the lesion area (PMID:28540528). Specification Tested Reactivity: Human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27173 Product name: Recombinant human SEMA3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-235 aa of BC111416 Sequence: ICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISES Predict reactive species Full Name: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A Calculated Molecular Weight: 771 aa, 89 kDa Observed Molecular Weight: 89 and 65 kDa GenBank Accession Number: BC111416 Gene Symbol: SEMA3A Gene ID (NCBI): 10371 RRID: AB_2880989 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14563 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.