Iright
BRAND / VENDOR: Proteintech

Proteintech, 27849-1-AP, SMIM1 Polyclonal antibody

CATALOG NUMBER: 27849-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMIM1 (27849-1-AP) by Proteintech is a Polyclonal antibody targeting SMIM1 in WB, ELISA applications with reactivity to Human, Mouse samples 27849-1-AP targets SMIM1 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Small integral membrane protein 1(SMIM1) is a type II transmembrane phosphoprotein and displays the Vel blood group antigen at its carboxyl-terminus. SMIM1 is highly expressed in hematopoietic cells. It is associated with a variety of immune responses and plays an important role in RBC differentiation. SMIM1 can be used as a potential biomarker for the diagnosis of IDD (PMID: 30906890; 26452714). Specification Tested Reactivity: Human, Mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27028 Product name: Recombinant human LOC388588 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-78 aa of BC146957 Sequence: MQPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKLGIAMKVLGGVALFWIIFILGYLTGYYVHKCK Predict reactive species Full Name: hypothetical LOC388588 Observed Molecular Weight: 9 kDa GenBank Accession Number: BC146957 Gene Symbol: SMIM1 Gene ID (NCBI): 388588 RRID: AB_2880993 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: B2RUZ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924