Iright
BRAND / VENDOR: Proteintech

Proteintech, 27876-1-AP, STK38 Polyclonal antibody

CATALOG NUMBER: 27876-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STK38 (27876-1-AP) by Proteintech is a Polyclonal antibody targeting STK38 in WB, ELISA applications with reactivity to human, mouse samples 27876-1-AP targets STK38 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, MCF-7 cells, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Serine/threonine-protein kinase 38 belongs to AGC Ser/Thr protein kinase family.STK38 implicates in cell proliferation and/or tumor progression, and might play a role in the HIV-1 life cycle.Researches showed that STK38 with STK38L, were proapoptotic kinases and key members of the RASSF1/STK4 signaling cascade and its kinase activity increased in early mitotic phase and was dependent on FRY and STK3. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27382 Product name: Recombinant human STK38 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 325-465 aa of BC012085 Sequence: ETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK Predict reactive species Full Name: serine/threonine kinase 38 Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC012085 Gene Symbol: STK38 Gene ID (NCBI): 11329 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15208 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924