Iright
BRAND / VENDOR: Proteintech

Proteintech, 27889-1-AP, NAP1L4 Polyclonal antibody

CATALOG NUMBER: 27889-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NAP1L4 (27889-1-AP) by Proteintech is a Polyclonal antibody targeting NAP1L4 in WB, ELISA applications with reactivity to Human, mouse, rat samples 27889-1-AP targets NAP1L4 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HuH-7 cells, mouse heart tissue, mouse testis tissue, rat heart tissue, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NAP1L4 is a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27469 Product name: Recombinant human NAP1L4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-375 aa of BC022090 Sequence: TKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV Predict reactive species Full Name: nucleosome assembly protein 1-like 4 Calculated Molecular Weight: 375 aa, 43 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC022090 Gene Symbol: NAP1L4 Gene ID (NCBI): 4676 RRID: AB_2881006 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99733 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924