Iright
BRAND / VENDOR: Proteintech

Proteintech, 27890-1-AP, UBE2J1 Polyclonal antibody

CATALOG NUMBER: 27890-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UBE2J1 (27890-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2J1 in WB, ELISA applications with reactivity to human samples 27890-1-AP targets UBE2J1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27310 Product name: Recombinant human UBE2J1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-283 aa of BC013973 Sequence: PTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTD Predict reactive species Full Name: ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) Calculated Molecular Weight: 318 aa, 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC013973 Gene Symbol: UBE2J1 Gene ID (NCBI): 51465 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y385 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924