Proteintech, 27936-1-AP, Maturin Polyclonal antibody

Size: 20ul / 150ul The Maturin (27936-1-AP) by Proteintech is a Polyclonal antibody targeting Maturin in WB, ELISA applications with reactivity to Human, mouse, pig, rat samples 27936-1-AP targets Maturin in WB, ELISA applications and shows reactivity with Human, mouse, pig, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, pig brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: Human, mouse, pig, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19932 Product name: Recombinant human C7orf41 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC156839 Sequence: MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSESEDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ Predict reactive species Full Name: chromosome 7 open reading frame 41 Calculated Molecular Weight: 131 aa, 15 kDa Observed Molecular Weight: 14-17 kDa GenBank Accession Number: BC156839 Gene Symbol: Maturin Gene ID (NCBI): 222166 RRID: AB_3086012 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3F0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.