Proteintech, 27938-1-AP, SLC10A6 Polyclonal antibody

Size: 20ul / 150ul The SLC10A6 (27938-1-AP) by Proteintech is a Polyclonal antibody targeting SLC10A6 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 27938-1-AP targets SLC10A6 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: mouse heart tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information SLC10A6, also named as SOAT, belongs to the SlC10 sodium-dependent bile acid (BA) transporter family. SLC10A6 is a transporter of steroid sulfates associated with spermatogenesis and fertility. It has been shown that SLC10A6 might be a new anti-proliferative breast cancer target as the SLC10A6 inhibition can affect the proliferation of breast cancer cells. SLC10A6 also plays a key role in hepatic inflammation. 27938-1-AP antibody detects the 70 kDa glycosylated form in SDS-PAGE. (PMID: 26510996, 30186172, 28893621) Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16609 Product name: Recombinant human SLC10A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-377 aa of BC107051 Sequence: GFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE Predict reactive species Full Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 6 Calculated Molecular Weight: 377 aa, 41 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC107051 Gene Symbol: SLC10A6 Gene ID (NCBI): 345274 RRID: AB_2881014 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3KNW5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.