Iright
BRAND / VENDOR: Proteintech

Proteintech, 27943-1-AP, GPD1 Polyclonal antibody

CATALOG NUMBER: 27943-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPD1 (27943-1-AP) by Proteintech is a Polyclonal antibody targeting GPD1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 27943-1-AP targets GPD1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: rat liver tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27703 Product name: Recombinant human GPD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-181 aa of BC032234 Sequence: VFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELM Predict reactive species Full Name: glycerol-3-phosphate dehydrogenase 1 (soluble) Calculated Molecular Weight: 349 aa, 38 kDa Observed Molecular Weight: 32-42 kDa GenBank Accession Number: BC032234 Gene Symbol: GPD1 Gene ID (NCBI): 2819 RRID: AB_2881016 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21695 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924