Iright
BRAND / VENDOR: Proteintech

Proteintech, 27970-1-AP, CAMKMT Polyclonal antibody

CATALOG NUMBER: 27970-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CAMKMT (27970-1-AP) by Proteintech is a Polyclonal antibody targeting CAMKMT in WB, IF/ICC, ELISA applications with reactivity to Mouse, Rat, Human samples 27970-1-AP targets CAMKMT in WB, IF/ICC, ELISA applications and shows reactivity with Mouse, Rat, Human samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CAMKMT, also named as C2orf34 and CLNMT, belongs to the class I-like SAM-binding methyltransferase superfamily and CLNMT methyltransferase family. The CAMKMT enzyme participates in cell cycle and development, regulating the production of calmodulin with three methyl lysine residues directly or indirectly. It also plays a major role in the calcium-dependent signaling pathway and posttranscriptional modifications, including Lys-115. CAMKMT is expressed mainly in the brain, liver, muscle, colon, and lung and is involved in muscle cell activities that are regulated by calcium binding (PMID: 27435482). The molecular weight of CAMKMT is 36 kDa. Specification Tested Reactivity: Mouse, Rat, Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27559 Product name: Recombinant human C2orf34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-311 aa of BC053733 Sequence: SADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEGHFDIVMCADCLFLDQYRASLVDAIKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENL Predict reactive species Full Name: chromosome 2 open reading frame 34 Calculated Molecular Weight: 323 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC053733 Gene Symbol: CAMKMT Gene ID (NCBI): 79823 RRID: AB_3669631 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z624 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924