Proteintech, 27977-1-AP, RHNO1 Polyclonal antibody

Size: 20ul / 150ul The RHNO1 (27977-1-AP) by Proteintech is a Polyclonal antibody targeting RHNO1 in IP, ELISA applications with reactivity to human, mouse samples 27977-1-AP targets RHNO1 in applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse thymus tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information RHNO1 (Rad9-Hus1-Rad1 Interacting Nuclear Orphan 1) is a protein associated with the DNA replication stress (DRS) response and DNA repair. It interacts with the 9-1-1 checkpoint clamp and TopBP1 to activate the ATR/Chk1 signaling pathway, thereby maintaining genomic integrity. Additionally, RHNO1 has been identified as a key facilitator of theta-mediated end joining (TMEJ), a DNA repair mechanism related to cancer progression and chemotherapy resistance. In cancer research, RHNO1 is considered a potential therapeutic target due to its high expression in tumor cells and its regulatory role in cell proliferation and survival. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14789 Product name: Recombinant human C12orf32 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-241 aa of BC005106 Sequence: HRLMPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPDFDTAAGSLFPAYQKHQNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESEKDVSRRPLVPVLSPQSCGNMSVQALQSLPYVFIPPDIQTPESSSVKEELIPQDQKENSLLSCTLHTGTPNSPEPGPVLVKDTPEDKYGIKVTWRRRQHLLAYLRERGKLSRSQFLVKS Predict reactive species Full Name: chromosome 12 open reading frame 32 Calculated Molecular Weight: 238 aa, 27 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC005106 Gene Symbol: C12orf32 Gene ID (NCBI): 83695 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BSD3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.