Iright
BRAND / VENDOR: Proteintech

Proteintech, 27989-1-AP, SPEF2 Polyclonal antibody

CATALOG NUMBER: 27989-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPEF2 (27989-1-AP) by Proteintech is a Polyclonal antibody targeting SPEF2 in WB, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 27989-1-AP targets SPEF2 in WB, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat testis tissue Positive IP detected in: rat testis tissue Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Sperm flagellar protein 2 (SPEF2) is also named KPL2. As a cilia-associated protein, SPEF2 is broadly expressed in various cilia-related organs, such as the lung, spleen, trachea, brain, and testis (PMID: 10100999). SPEF2 is known to be essential for sperm tail development (PMID: 28619825). During spermatogenesis, SPEF2 is weakly expressed in cytoplasm in pachytene spermatocytes and round spermatocytes, then SPEF2 is localized in the manchette of steps 10-12 elongating spermatids, in the basal body at steps 13-14, and finally in the midpiece of the sperm tail at steps 14-16 (PMID: 19889948). Spef2 is expressed in the bone and cartilage, and Spef2 expression in osteoblasts increases during in vitro differentiation (PMID: 29339787). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27506 Product name: Recombinant human SPEF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 103-316 aa of NM_024867 Sequence: MALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQERLRHMIPRQTDFNLMRITYRFQEKYKHVKEDLAHLHFEKLERFQKLKEEQRCFDIEKQYLNRRRQNEIMAKIQAAIIQIPKPASNRTLKALEAQKMMKKKKEAEDVADEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDDEYIKKIQKRLEEDAFAREQREKRRRKLLM Predict reactive species Full Name: sperm flagellar 2 Calculated Molecular Weight: 210 kDa Observed Molecular Weight: 210 kDa GenBank Accession Number: NM_024867 Gene Symbol: SPEF2 Gene ID (NCBI): 79925 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C093 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924