Iright
BRAND / VENDOR: Proteintech

Proteintech, 28007-1-AP, JNK Polyclonal antibody

CATALOG NUMBER: 28007-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The JNK (28007-1-AP) by Proteintech is a Polyclonal antibody targeting JNK in WB, IHC, ELISA applications with reactivity to Human, Mouse, canine samples 28007-1-AP targets JNK in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, canine samples. Tested Applications Positive WB detected in: Neuro-2a cells, MDCK cells, mouse brain tissue, mouse cerebellum tissue Positive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information JNK, also named MAPK10 (mitogen-activated protein kinase 10), belongs to MAP kinase family. MAP kinases act as integration points for multiple biochemical signals, and thus are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcription regulation and development. This kinase is mainly expressed in a subset of neurons in the nervous system, and is activated by threonine and tyrosine phosphorylation. JNK has 3 isoforms of 48-53 kDa. Specification Tested Reactivity: Human, Mouse, canine Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27823 Product name: Recombinant human MAPK10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-408 aa of BC065516 Sequence: QWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNG Predict reactive species Full Name: mitogen-activated protein kinase 10 Calculated Molecular Weight: 464 aa, 53 kDa Observed Molecular Weight: 45-48 kDa, 54-57 kDa GenBank Accession Number: BC065516 Gene Symbol: JNK3 Gene ID (NCBI): 5602 RRID: AB_2881035 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53779 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924