Iright
BRAND / VENDOR: Proteintech

Proteintech, 28015-1-AP, CRB2 Polyclonal antibody

CATALOG NUMBER: 28015-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRB2 (28015-1-AP) by Proteintech is a Polyclonal antibody targeting CRB2 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 28015-1-AP targets CRB2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CRB2 (Crumbs homolog-2) has a large extracellular domain with epidermal growth-factor-like and laminin-A globular domains, a single transmembrane domain, and an intracellular C-terminal domain of 37 amino acids (PMID: 31438467). CRB2 is a candidate modifying gene of human CRB1-related retinal dystrophy (PMID: 24565864). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27826 Product name: Recombinant human CRB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 102-282 aa of NM_173689 Sequence: MGPRCELDIDECASRPCHHGATCRNLADRYECHCPLGYAGVTCEMEVDECASAPCLHGGSCLDGVGSFRCVCAPGYGGTRCQLDLDECQSQPCAHGGTCHDLVNGFRCDCAGTGYEGTHCEREVLECASAPCEHNASCLEGLGSFRCLCWPGYSGELCEVDEDECASSPCQHGGRCLQRSDP Predict reactive species Full Name: crumbs homolog 2 (Drosophila) Calculated Molecular Weight: 134 aa GenBank Accession Number: NM_173689 Gene Symbol: CRB2 Gene ID (NCBI): 286204 RRID: AB_3669636 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5IJ48 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924