Proteintech, 28031-1-AP, TMEM184B Polyclonal antibody

Size: 20ul / 150ul The TMEM184B (28031-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM184B in IHC, ELISA applications with reactivity to Human samples 28031-1-AP targets TMEM184B in IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Transmembrane protein 184B (TMEM184B) is a seven-pass transmembrane protein highly expressed in the nervous system and is thought to play a role in neuronal excitability, synaptic structure, and expression of key developmental and adult pathways involved in neuronal differentiation (PMID: 27122027; 37730546). TMEM184B may activate the MAP kinase signaling pathway (PMID: 12761501). TMEM184B has also been reported to be necessary for interleukin-31-induced itch, promoting adult somatosensation through developmental Wnt signaling and promotion of proper pruriceptive gene expression (PMID: 34629389). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27704 Product name: Recombinant human TMEM184B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 318-407 aa of BC015489 Sequence: VYADKRLDAQGRCAPMKSISSSLKETMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEF Predict reactive species Full Name: transmembrane protein 184B GenBank Accession Number: BC015489 Gene Symbol: TMEM184B Gene ID (NCBI): 25829 RRID: AB_3086023 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y519 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.