Iright
BRAND / VENDOR: Proteintech

Proteintech, 28037-1-AP, CLK3 Polyclonal antibody

CATALOG NUMBER: 28037-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CLK3 (28037-1-AP) by Proteintech is a Polyclonal antibody targeting CLK3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 28037-1-AP targets CLK3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, MCF-7 cells, mouse testis tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CLK3 (CDC Like Kinase 3) encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that functions on substrates containing serine/threonine and tyrosine. CLK3 modulates RNA splicing by phosphorylating serine/arginine-rich proteins such as SRSF1 and SRSF3. CLK3 dysregulation was indicated to be a high-penetrant factor in different types of human tumors even though its functions in tumors were not clearly characterized (PMID: 32453420). CLK3 has 4 isoforms, which is 74kDa, 59kDa, 56kDa and 18kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27741 Product name: Recombinant human CLK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC002555 Sequence: MHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASS Predict reactive species Full Name: CDC-like kinase 3 Calculated Molecular Weight: 73 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC002555 Gene Symbol: CLK3 Gene ID (NCBI): 1198 RRID: AB_3669638 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49761 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924