Iright
BRAND / VENDOR: Proteintech

Proteintech, 28045-1-AP, RAD52 Polyclonal antibody

CATALOG NUMBER: 28045-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAD52 (28045-1-AP) by Proteintech is a Polyclonal antibody targeting RAD52 in WB, IP, ELISA applications with reactivity to human samples 28045-1-AP targets RAD52 in WB, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HL-60 cells, HepG2 cells Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27619 Product name: Recombinant human RAD52 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-418 aa of NM_001297419 Sequence: MADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS Predict reactive species Full Name: RAD52 homolog (S. cerevisiae) Calculated Molecular Weight: 46 aa Observed Molecular Weight: 46-50 kDa GenBank Accession Number: NM_001297419 Gene Symbol: RAD52 Gene ID (NCBI): 5893 RRID: AB_2881046 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43351 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924