Proteintech, 28046-1-AP, SON Polyclonal antibody

Size: 20ul / 150ul The SON (28046-1-AP) by Proteintech is a Polyclonal antibody targeting SON in IHC, ELISA applications with reactivity to human, mouse samples 28046-1-AP targets SON in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human thyroid cancer tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Background Information SON, also called C21orf50 and DBP5, is a nuclear speckle-localized protein that shares homology with pre-mRNA splicing accessory factors (PMID: 10950926). It is an RNA-binding protein that acts as an mRNA splicing cofactor by promoting efficient splicing of transcripts that possess weak splice sites, and specifically promotes splicing of many cell-cycle and DNA-repair transcripts that possess weak splice sites, such as TUBG1, KATNB1, TUBGCP2, AURKB, PCNT, AKT1, RAD23A, and FANCG (PMID: 20581448; 21504830). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27620 Product name: Recombinant human SON protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-182 aa of NM_001291411 Sequence: MVSKFREIQQELSSGRNEGQLNGETNTPIEGNQAGDAAASARSLPNEEIVQKIEEVLSGVLDTELRYKPDLKEGSRKSRCVSVQTDPTDEIPTKKSKKHKKHKNKKKKKKKEKEKKYKRQPEESESKTKSHDDGNIDLESDSFLKFDSEPSAVALELPTRAFGPSETNES Predict reactive species Full Name: SON DNA binding protein Calculated Molecular Weight: 264 aa GenBank Accession Number: NM_001291411 Gene Symbol: SON Gene ID (NCBI): 6651 RRID: AB_3086024 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18583 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.