Product Description
Size: 20ul / 150ul
The PPARD (28053-1-AP) by Proteintech is a Polyclonal antibody targeting PPARD in WB, ELISA applications with reactivity to Human samples
28053-1-AP targets PPARD in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Applications
Positive WB detected in: human placenta tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: Human
Cited Reactivity: human, bovine
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag27817 Product name: Recombinant human PPARD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC002715 Sequence: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNME Predict reactive species
Full Name: peroxisome proliferator-activated receptor delta
Calculated Molecular Weight: 50 kDa
Observed Molecular Weight: 50 kDa
GenBank Accession Number: BC002715
Gene Symbol: PPARD
Gene ID (NCBI): 5467
RRID: AB_2918143
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q03181
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924