Proteintech, 28090-1-AP, CAMK2N2 Polyclonal antibody

Size: 20ul / 150ul The CAMK2N2 (28090-1-AP) by Proteintech is a Polyclonal antibody targeting CAMK2N2 in IHC, ELISA applications with reactivity to Human, mouse samples 28090-1-AP targets CAMK2N2 in IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Calcium/calmodulin-dependent protein kinase II (CaMKII) is a key synaptic signaling molecule that regulates numerous physiological functions. CaMK2N2, also known as CAMKIIN, is one of the endogenous inhibitors of CaMKII. CaMK2N2 plays an important role in the regulation of cell growth (PMID: 11444830). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26872 Product name: Recombinant human CAMK2N2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC105077 Sequence: MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV Predict reactive species Full Name: calcium/calmodulin-dependent protein kinase II inhibitor 2 GenBank Accession Number: BC105077 Gene Symbol: CAMK2N2 Gene ID (NCBI): 94032 RRID: AB_3086027 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96S95 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.