Proteintech, 28091-1-AP, NRSN1 Polyclonal antibody

Size: 20ul / 150ul The NRSN1 (28091-1-AP) by Proteintech is a Polyclonal antibody targeting NRSN1 in WB, ELISA applications with reactivity to human, mouse, rat samples 28091-1-AP targets NRSN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information NRSN1, also named as VMP and Neuro-p24, is a vesicular membrane protein with MW 24 kDa. It is a unique membranous protein that has a microtubule-binding domain and is specifically expressed in neurons. NRSN1 plays an active role in axonal regeneration as well as in embryonic development and neurite extension. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25972 Product name: Recombinant human NRSN1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 90-195 aa of BC023514 Sequence: IEAFGEADFVVVDTHAVQFNSALDMYKLAGAVLFCIGGTSMAGCLLMSVFVKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT Predict reactive species Full Name: neurensin 1 Calculated Molecular Weight: 195 aa, 21 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC023514 Gene Symbol: NRSN1 Gene ID (NCBI): 140767 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZ57 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.