Proteintech, 28096-1-AP, GPR141 Polyclonal antibody

Size: 20ul / 150ul The GPR141 (28096-1-AP) by Proteintech is a Polyclonal antibody targeting GPR141 in IHC, ELISA applications with reactivity to Human, mouse samples 28096-1-AP targets GPR141 in IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPR141 (G-protein-coupled receptor 141) is a class A orphan receptor molecule of the rhodopsin family. Increased GPR141 expression enhances the migratory behavior of breast cancer, driving oncogenic pathways both in vitro and in vivo through activation of epithelial to mesenchymal transition (EMT), oncogenic mediators, and regulation of p-mTOR/p53 signaling (PMID: 37204251). Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23129 Product name: Recombinant human GPR141 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 246-305 aa of BC120951 Sequence: IYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCR Predict reactive species Full Name: G protein-coupled receptor 141 Calculated Molecular Weight: 305 aa, 35 kDa GenBank Accession Number: BC120951 Gene Symbol: GPR141 Gene ID (NCBI): 353345 RRID: AB_3086028 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z602 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.