Iright
BRAND / VENDOR: Proteintech

Proteintech, 28108-1-AP, FC tag Polyclonal antibody

CATALOG NUMBER: 28108-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FC tag (28108-1-AP) by Proteintech is a Polyclonal antibody targeting FC tag in WB, ELISA applications with reactivity to mouse samples 28108-1-AP targets FC tag in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information This antibody detects the Fc fragment of mouse IgG2a. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27844 Product name: Recombinant mouse FC tag protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-232 aa of Sequence: PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK Predict reactive species Full Name: FC tag Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 55 kDa RRID: AB_3086029 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924