Proteintech, 28114-1-AP, UQCC Polyclonal antibody

Size: 20ul / 150ul The UQCC (28114-1-AP) by Proteintech is a Polyclonal antibody targeting UQCC in WB, IHC, ELISA applications with reactivity to human samples 28114-1-AP targets UQCC in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, MCF-7 cells, LNCaP cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information UQCC is a transmembrane protein that is structurally similar to the mouse basic fibroblast growth factor repressed ZIC-binding protein. In mouse this protein may be involved in fibroblast growth factor regulated growth control. In humans, polymorphisms in this gene are associated with variation in human height and osteoarthritis. Alternate splicing results in multiple transcript variant. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27123 Product name: Recombinant human UQCC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-299 aa of BC105791 Sequence: PDTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVHFMWEDVQQRGRVMGVNPYILKKNMILMTNHFYAAILGYDEGILSDDHGLAAALWRTFFNRKCEDPRHLELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSPTYNDEGL Predict reactive species Full Name: ubiquinol-cytochrome c reductase complex chaperone Calculated Molecular Weight: 299 aa, 35 kDa Observed Molecular Weight: 21-27 kDa GenBank Accession Number: BC105791 Gene Symbol: UQCC Gene ID (NCBI): 55245 RRID: AB_2881065 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.