Iright
BRAND / VENDOR: Proteintech

Proteintech, 28127-1-AP, ZBTB7B Polyclonal antibody

CATALOG NUMBER: 28127-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZBTB7B (28127-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB7B in WB, ELISA applications with reactivity to Human, mouse samples 28127-1-AP targets ZBTB7B in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ZBTB7B, also known as Zfp-67 or Zinc finger protein Th-POK, is a 539 amino acid protein, which localizes in nucleus. ZBTB7B as a transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. ZBTB7B is necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. The calcualted molecular weight of ZBTB7B is about 58 kDa, but modified protein is 70 kDa. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27970 Product name: Recombinant human ZBTB7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-350 aa of BC012070 Sequence: APSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPTVPAHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPV Predict reactive species Full Name: zinc finger and BTB domain containing 7B Calculated Molecular Weight: 539 aa, 58 kDa Observed Molecular Weight: 70 kda GenBank Accession Number: BC012070 Gene Symbol: ZBTB7B Gene ID (NCBI): 51043 RRID: AB_2881068 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15156 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924